PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0225s0012.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 605aa    MW: 68630.2 Da    PI: 6.1037
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0225s0012.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3495.92.1e-151494201353
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          +el+krmw+d+m+lkrlke++k     k+  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+
  Kalax.0225s0012.3.p  49 DELEKRMWRDKMRLKRLKEQTKT----KDG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDN 133
                          79******************997....677.9********************************************************** PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          Lr+WWk+kv+fdrngpaai+kyqa+n i++++++ ++   s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekg++pPWWPtGke+w
  Kalax.0225s0012.3.p 134 LREWWKDKVRFDRNGPAAIAKYQAENSIPGNSEGANS-VGSTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGISPPWWPTGKEEW 222
                          ******************************9999987.9*************************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.XXXX CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.slrk 269
                          w++l ++k+qg+ pykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee ++++++++s   +  
  Kalax.0225s0012.3.p 223 WSQLDIPKNQGPLPYKKPHDLKKAWKVGVLTAVIKHMSPDISKIRKLVRQSKCLQDKMTAKESATWLAIINQEETLARELYPDSCfPSYG 312
                          ***********************************************************************************7754455 PP

                          XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..........................XXXXXXXXXXXXXXXXXXXXX......XXXX CS
                 EIN3 270 qspkvtlsceqkedvegkkeskikhvqavktta..........................gfpvvrkrkkkpsesakvsskevsrtcqssq 333
                          +  ++ +++  ++dveg  + +  + q +k  +                          +++++rkrk ++se + v ++  ++tc+   
  Kalax.0225s0012.3.p 313 DISSIGFNDCGEYDVEGPGDDHKFEYQDQKPIKltlpdlavkdtkgfttnqppysfvdvNVDIARKRK-PSSELNRVTEQ-NIYTCEFLP 400
                          88899999999*****77777767888888888999*********************77777777777.55555555555.56******* PP

                          XXX.XXXXXXXXXXXXXXXX CS
                 EIN3 334 frgsetelifadknsisqne 353
                          +++se++l+f+d+ s+++++
  Kalax.0225s0012.3.p 401 CPYSESHLGFHDRISRDNHQ 420
                          ******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.0E-12949296No hitNo description
Gene3DG3DSA:1.10.3180.105.3E-74169306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167685.49E-60175299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MMMFDEMGYC GDVNFFCAPP QVERVEPLQQ NELDGAVEDD YSDEELDVDE LEKRMWRDKM  60
RLKRLKEQTK TKDGVDAAKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PEKGKPVTGA SDNLREWWKD KVRFDRNGPA AIAKYQAENS IPGNSEGANS VGSTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGI SPPWWPTGKE EWWSQLDIPK NQGPLPYKKP  240
HDLKKAWKVG VLTAVIKHMS PDISKIRKLV RQSKCLQDKM TAKESATWLA IINQEETLAR  300
ELYPDSCFPS YGDISSIGFN DCGEYDVEGP GDDHKFEYQD QKPIKLTLPD LAVKDTKGFT  360
TNQPPYSFVD VNVDIARKRK PSSELNRVTE QNIYTCEFLP CPYSESHLGF HDRISRDNHQ  420
LSCPFKSISS DPVVMQFHEG KSFNFHQSIL QPNQAAQPAS LAQSTFSLPG VGVPEDGQRM  480
ISGLMSYYDS NVQKNKFADS QNLNQNVPQP VPQHQHVKYS FNDSQGFTME NNFFDTPNIP  540
ASHHMFVQEQ GHLDPSKMLN PQFEMNHGGN TLQMIYGPTF DAVASDFSDG ISSTYPKQVS  600
VWYP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B4e-831733061134Protein ETHYLENE INSENSITIVE 3
4zds_A4e-831733061134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016682.10.0Ethylene insensitive 3 family protein
RefseqXP_015873379.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0R5PAD20.0A0A0R5PAD2_CARPA; Ethylene insensitive 3-like 1
STRINGGLYMA20G12250.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein